Cat: PA1000-2773

Recombinant Human RPS10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RPS10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RPS10;Small ribosomal subunit Protein eS10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P46783

  • Expression Region

    1-165aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMLMPKKNRIAIYELLFKEGVMVAKKDV HMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQ YLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTY RRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RPS10, a component of the ribosomal protein family, plays a critical role in the biogenesis of ribosomes and protein synthesis within cells. Ribosomal proteins, including RPS10, are essential for the assembly of ribosomal RNA and ribosomal subunits, which are crucial for translating messenger RNA into proteins. Recent studies have highlighted the significance of RPS10 in various cellular processes, including cell growth, proliferation, and stress responses. The dysregulation of ribosomal proteins, including RPS10, has been linked to several diseases, including cancer, where altered ribosomal function can contribute to uncontrolled cell proliferation. Research efforts have focused on the characterization of RPS10 through recombinant protein expression and purification techniques, allowing for in-depth studies of its structure, function, and interactions with other ribosomal components and regulatory factors. Understanding the precise role of RPS10 in ribosome assembly and function may unveil new therapeutic targets for diseases associated with ribosomal dysfunction. This research aims to elucidate the mechanisms by which RPS10 contributes to ribosome integrity and overall cellular homeostasis, providing insights into its broader implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US