Analytical Data
-
Gene name
PLP2
- Application
-
Alternative Names
PLP2;A4;Proteolipid Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04941
-
Expression Region
1-152aa
-
AA Sequence
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLP2, or Proteolipid Protein 2, is a gene that plays a critical role in the central nervous system, particularly in the formation and maintenance of myelin sheaths around neuronal axons. Research into PLP2 has gained attention due to its involvement in various neurological disorders, including multiple sclerosis and Pelizaeus-Merzbacher disease, where myelin degeneration occurs. The protein is essential for oligodendrocyte function—the cells responsible for producing myelin. Understanding the structure and function of PLP2 has significant implications for developing therapeutic strategies aimed at repairing or regenerating myelin in demyelinating diseases. Recombinant PLP2 proteins have been produced to investigate their biochemical properties, interactions, and potential as biomarkers or therapeutic agents. The study of PLP2 also offers insights into the molecular mechanisms underlying myelination and the pathophysiology of related neurological conditions. Therefore, the exploration of PLP2 not only enhances our understanding of fundamental neurobiology but also paves the way for innovative treatments targeting myelin repair and restoration.
