Analytical Data
-
Gene name
NFAT5
- Application
-
Alternative Names
Glutamine rich protein H65; KIAA0827; NF AT5; NF-AT5; NFAT 5; NFAT L1; NFAT like protein 1; NFAT5; NFAT5_HUMAN; NFATL 1; NFATL1; NFATZ; Nuclear factor of activated T cells 5; Nuclear factor of activated T cells 5 tonicity responsive; Nuclear factor of activated T cells; Nuclear factor of activated T-cells 5; OREBP; Osmotic response element binding protein; T cell transcription factor NFAT 5; T cell transcription factor NFAT5; T-cell transcription factor NFAT5; TonE binding protein; TonE-binding protein; TonEBP; Tonicity responsive enhancer binding protein; Tonicity-responsive enhancer-binding protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O94916
-
Expression Region
1422-1531 aa
-
AA Sequence
FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NFAT5, a member of the Nuclear Factor of Activated T-cells (NFAT) family, plays a crucial role in cellular responses to osmotic stress and is involved in various physiological processes, including immune response, cell differentiation, and survival. Research has increasingly focused on NFAT5 due to its significance in pathologies such as inflammation, cancer, and cardiovascular diseases. The ability of NFAT5 to regulate gene expression in response to hypertonic stress highlights its potential as a therapeutic target. Recent studies have demonstrated that NFAT5 functions as a transcription factor, modulating the expression of genes involved in osmotic regulation and promoting cell adaptation under stress conditions. The recombinant protein of NFAT5 has been utilized in various experimental setups to elucidate its mechanisms of action and interactions with other proteins and signaling pathways. By generating NFAT5 as a recombinant protein, researchers aim to investigate its structural characteristics, functional domains, and post-translational modifications, which can provide deeper insights into its role in health and disease. Overall, the study of NFAT5 recombinant protein contributes to understanding the molecular mechanisms underlying cellular responses to stress and offers potential pathways for developing novel therapeutic interventions.
