Cat: PA2000-1116

Recombinant Human WIPF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WIPF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WIPF1;WASPIP;WIP;WAS/WASL-interacting Protein family member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43516

  • Expression Region

    1-358aa

  • AA Sequence

    MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTV TNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGL GGLFQAGMPKLRSTANRDNHSGGSRPPLLPPGGRSTSAKPFSPPSGPGRF PVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHN RGSPPVPGGPRQPSPGPTPPPPPVRDPPGRSGPLPPPPPVSRNGSTSRAL PATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSP CEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGA PPLPPIPR

  • Molecular Weight

    63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WIPF1, or Wiskott-Aldrich syndrome protein family member 1, is a protein that has garnered significant interest due to its role in cytoskeletal dynamics and cellular signaling. Initially identified in the context of the immune response, WIPF1 is known to interact with actin and various signaling molecules, making it crucial for processes such as cell migration, adhesion, and immune cell activation. Recent studies have highlighted its involvement in several pathological conditions, including cancer metastasis and autoimmune diseases. The recombinant expression of WIPF1 enables researchers to elucidate its functional mechanisms and explore its potential as a biomarker for disease progression. Additionally, WIPF1's interactions with other proteins present opportunities for targeted therapeutic interventions. By studying WIPF1 in various cellular contexts, scientists aim to uncover its full biological significance and potential implications in health and disease. As a result, the generation of WIPF1 recombinant proteins is pivotal for advancing our understanding of its multifaceted roles in cellular processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US