Cat: PA1000-2731

Recombinant Human RLN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RLN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RLN2;Prorelaxin H2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04090

  • Expression Region

    25-185aa

  • AA Sequence

    MGSSHHHHHHMGSSHHHHHHSSGLVPRGSHMGSDSWMEEVIKLCGRELVR AQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFV ANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAA DSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Recombinant RLN2 (Relaxin 2) is a peptide hormone that belongs to the relaxin family, playing a crucial role in various physiological processes, including reproductive functions and cardiovascular regulation. Historically, research on RLN2 has focused on its involvement in pregnancy, where it is produced by the corpus luteum and is thought to facilitate uterine remodeling, cervical softening, and angiogenesis. Beyond its reproductive implications, emerging studies have revealed that RLN2 may exhibit therapeutic potential in the treatment of various cardiovascular diseases by promoting vasodilation and inhibiting fibrosis. Additionally, RLN2 is being explored for its roles in metabolic regulation, neuroprotection, and modulating inflammation, making it a target of interest in multiple biomedical research areas. The advent of recombinant technology allows for the efficient production of RLN2, enabling further exploration of its molecular mechanisms, signaling pathways, and therapeutic applications. Current studies are investigating the optimal delivery methods and formulations of RLN2 to maximize its biological activity and therapeutic effectiveness. As our understanding of RLN2 expands, it holds promise for innovative treatments for conditions such as heart failure, diabetes, and other disorders linked to its regulatory functions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US