Analytical Data
-
Gene name
RLN2
- Application
-
Alternative Names
RLN2;Prorelaxin H2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04090
-
Expression Region
25-185aa
-
AA Sequence
MGSSHHHHHHMGSSHHHHHHSSGLVPRGSHMGSDSWMEEVIKLCGRELVR AQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFV ANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAA DSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Recombinant RLN2 (Relaxin 2) is a peptide hormone that belongs to the relaxin family, playing a crucial role in various physiological processes, including reproductive functions and cardiovascular regulation. Historically, research on RLN2 has focused on its involvement in pregnancy, where it is produced by the corpus luteum and is thought to facilitate uterine remodeling, cervical softening, and angiogenesis. Beyond its reproductive implications, emerging studies have revealed that RLN2 may exhibit therapeutic potential in the treatment of various cardiovascular diseases by promoting vasodilation and inhibiting fibrosis. Additionally, RLN2 is being explored for its roles in metabolic regulation, neuroprotection, and modulating inflammation, making it a target of interest in multiple biomedical research areas. The advent of recombinant technology allows for the efficient production of RLN2, enabling further exploration of its molecular mechanisms, signaling pathways, and therapeutic applications. Current studies are investigating the optimal delivery methods and formulations of RLN2 to maximize its biological activity and therapeutic effectiveness. As our understanding of RLN2 expands, it holds promise for innovative treatments for conditions such as heart failure, diabetes, and other disorders linked to its regulatory functions.











