Cat: PA2000-1047

Recombinant Human NPPA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPPA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPPA;MURC;Caveolae-associated Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01160

  • Expression Region

    78-115aa

  • AA Sequence

    PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL

  • Molecular Weight

    5.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NPPA (Natriuretic Peptide A), also known as atrial natriuretic peptide (ANP), plays a crucial role in cardiovascular homeostasis and fluid balance. Discovered in the 1980s, NPPA is predominantly secreted by the atria of the heart in response to increased arterial tension and volume overload. Its primary functions include promoting vasodilation, regulating sodium excretion, and inhibiting renin-angiotensin-aldosterone system activity, making it vital for managing hypertension and heart failure. Due to its significant physiological roles, NPPA has been a subject of intense research aimed at understanding its structure, function, and potential therapeutic applications. Advances in recombinant DNA technology have enabled the production of NPPA as a recombinant protein, facilitating detailed studies on its therapeutic viability and interaction with its receptor, NPR-A (Natriuretic Peptide Receptor A). Research into NPPA's biomolecular properties and its involvement in pathological conditions has opened avenues for novel treatments, including the possibility of using NPPA or its analogs as a therapeutic agent in cardiovascular diseases. Given the increasing global prevalence of heart-related disorders, the exploration of NPPA as a biomarker and therapeutic target remains a promising and active area of investigation in biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US