Analytical Data
-
Gene name
MYOM3
- Application
-
Alternative Names
MYOM3; MYOM3_HUMAN; Myomesin family member 3; Myomesin-3; RP11-293P20.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VTT5
-
Expression Region
854-955 aa
-
AA Sequence
GPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIG
-
Molecular Weight
36.96 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYOM3 is a member of the myomesin family, which is a group of proteins primarily found in cardiac and skeletal muscles. These proteins play a crucial role in muscle contraction and structural integrity of the myofibrils. Recent studies have highlighted the significance of MYOM3 in muscle development and pathophysiology, particularly its involvement in various muscle disorders. Research into MYOM3 recombinant proteins has gained traction as scientists aim to elucidate the molecular mechanisms underlying its function and interaction with other muscle proteins. Recombinant MYOM3 offers an invaluable tool for investigating its biochemical properties, such as binding affinity, structural stability, and its role in muscle cell signaling pathways. Moreover, this research could provide insights into potential therapeutic targets for diseases characterized by muscle degeneration, such as cardiomyopathies and muscular dystrophies. By understanding the functional attributes of MYOM3 through recombinant approaches, researchers hope to pave the way for innovative strategies in regenerative medicine and muscle repair, addressing the pressing need for effective treatments in the field of muscle-related disorders.
