Analytical Data
-
Gene name
RAB3D
- Application
-
Alternative Names
RAB3D;GOV;RAB16;Ras-related Protein Rab-3D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95716
-
Expression Region
1-219aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGN SSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQV ILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB3D is a member of the RAB family of small GTPases, which are crucial regulators of intracellular transport and vesicle trafficking. It plays a significant role in the exocytosis of neurotransmitter-containing vesicles, particularly in the neuronal and endocrine systems. Structural studies have demonstrated that RAB3D interacts with various effector proteins, influencing synaptic release and hormone secretion. Its involvement in synaptic plasticity has garnered attention, making it a critical factor in the study of neurobiology and related disorders. The understanding of RAB3D's functional mechanisms has potential implications for therapeutic strategies targeting neurological diseases and metabolic disorders. Recent advances in recombinant protein technology have enabled researchers to produce RAB3D protein in a controlled manner, facilitating detailed investigations into its biochemical properties and interactions. This research background highlights the importance of RAB3D in cellular signaling pathways and emphasizes the need for continued exploration of its biological functions and implications in health and disease.
