Analytical Data
-
Gene name
RAB35
- Application
-
Alternative Names
RAB35;RAB1C;RAY;Ras-related Protein Rab-35
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15286
-
Expression Region
1-201aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFAD NTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRG THGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVV ETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQ QQQQNDVVKLTKNSKRKKRCC
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB35 is a member of the RAS superfamily of small GTPases, playing a crucial role in various cellular processes, including vesicle trafficking, endocytosis, and membrane dynamics. Recent studies have highlighted its importance in regulating membrane transport events, particularly in relation to the recycling of endosomal vesicles. Dysregulation of RAB35 has been implicated in various diseases, including cancer and neurodegenerative disorders, making it a significant target for therapeutic interventions. The ability to produce recombinant RAB35 protein is essential for understanding its structural and functional properties, as well as its interactions with other cellular components. By studying RAB35 in a recombinant system, researchers aim to elucidate its mechanistic roles in intracellular pathways and its potential as a biomarker or therapeutic target. Furthermore, understanding the signaling pathways mediated by RAB35 may provide insights into the broader network of cellular regulation and how alterations in this protein contribute to disease pathology. Consequently, the development of recombinant RAB35 not only enhances our basic knowledge of cellular mechanisms but also opens up new avenues for the development of biotechnological and pharmacological applications.











