Cat: PA1000-2624

Recombinant Human RAB35 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB35

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB35;RAB1C;RAY;Ras-related Protein Rab-35

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15286

  • Expression Region

    1-201aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFAD NTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRG THGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVV ETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQ QQQQNDVVKLTKNSKRKKRCC

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB35 is a member of the RAS superfamily of small GTPases, playing a crucial role in various cellular processes, including vesicle trafficking, endocytosis, and membrane dynamics. Recent studies have highlighted its importance in regulating membrane transport events, particularly in relation to the recycling of endosomal vesicles. Dysregulation of RAB35 has been implicated in various diseases, including cancer and neurodegenerative disorders, making it a significant target for therapeutic interventions. The ability to produce recombinant RAB35 protein is essential for understanding its structural and functional properties, as well as its interactions with other cellular components. By studying RAB35 in a recombinant system, researchers aim to elucidate its mechanistic roles in intracellular pathways and its potential as a biomarker or therapeutic target. Furthermore, understanding the signaling pathways mediated by RAB35 may provide insights into the broader network of cellular regulation and how alterations in this protein contribute to disease pathology. Consequently, the development of recombinant RAB35 not only enhances our basic knowledge of cellular mechanisms but also opens up new avenues for the development of biotechnological and pharmacological applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US