Analytical Data
-
Gene name
RAB34
- Application
-
Alternative Names
RAB34;RAB39;RAH;Ras-related Protein Rab-34
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZG1
-
Expression Region
1-259aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMNILAPVRRDRVLAELPQCLRKEAALHGHK DFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKN YKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIII VFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALME KDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGA RRIGDVVRINSDDSNLYLTASKKKPTCCP
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB34 is a member of the RAS superfamily of small GTPases, which play crucial roles in intracellular trafficking, membrane transport, and cellular signaling. Recent studies have highlighted the involvement of RAB34 in various cellular processes, including endocytosis, exocytosis, and organelle dynamics, making it a significant focus in cell biology and molecular research. Understanding the functional mechanisms of RAB34 is essential for unraveling its contributions to normal cellular physiology and potential implications in disease states, such as cancer and neurodegenerative disorders. Recombinant RAB34 proteins have been produced to elucidate its structural features and functional roles, enabling researchers to explore its interaction with effector proteins and its regulation by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). Investigating RAB34 through recombinant techniques also facilitates high-throughput screening of potential therapeutic agents that may target RAB34-related pathways. Overall, the study of recombinant RAB34 proteins is pivotal for advancing our understanding of this GTPase's role in cellular homeostasis and its potential as a biomarker or therapeutic target in various diseases.











