Cat: PA1000-2623

Recombinant Human RAB34 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB34

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB34;RAB39;RAH;Ras-related Protein Rab-34

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BZG1

  • Expression Region

    1-259aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMNILAPVRRDRVLAELPQCLRKEAALHGHK DFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKN YKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIII VFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALME KDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGA RRIGDVVRINSDDSNLYLTASKKKPTCCP

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB34 is a member of the RAS superfamily of small GTPases, which play crucial roles in intracellular trafficking, membrane transport, and cellular signaling. Recent studies have highlighted the involvement of RAB34 in various cellular processes, including endocytosis, exocytosis, and organelle dynamics, making it a significant focus in cell biology and molecular research. Understanding the functional mechanisms of RAB34 is essential for unraveling its contributions to normal cellular physiology and potential implications in disease states, such as cancer and neurodegenerative disorders. Recombinant RAB34 proteins have been produced to elucidate its structural features and functional roles, enabling researchers to explore its interaction with effector proteins and its regulation by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). Investigating RAB34 through recombinant techniques also facilitates high-throughput screening of potential therapeutic agents that may target RAB34-related pathways. Overall, the study of recombinant RAB34 proteins is pivotal for advancing our understanding of this GTPase's role in cellular homeostasis and its potential as a biomarker or therapeutic target in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US