Analytical Data
-
Gene name
HPCAL4
- Application
-
Alternative Names
HPCAL4；Hippocalcin-like Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UM19
-
Expression Region
2-191aa
-
AA Sequence
GKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK
-
Molecular Weight
22.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HPCAL4, a member of the high-capacity calcium-binding protein family, has garnered significant interest in the field of molecular biology due to its potential roles in calcium signaling and cellular functions. The protein is believed to participate in various physiological processes, including neuronal signaling, muscle contraction, and cellular development. Recent studies suggest that HPCAL4 may play a crucial role in regulating intracellular calcium levels, which are vital for maintaining cellular homeostasis and facilitating communication between cells. Moreover, dysregulation of calcium signaling has been implicated in several diseases, including neurodegenerative disorders and cardiovascular diseases, highlighting the importance of understanding HPCAL4's role in these pathways. Researchers are focusing on the recombinant expression of HPCAL4 to study its structural properties and functional mechanisms in a controlled setting, providing insights into its biological implications. The generation of recombinant HPCAL4 allows for detailed investigations of its binding affinity to calcium ions and interactions with other cellular proteins, paving the way for potential therapeutic applications targeting calcium-related disorders. Overall, the study of HPCAL4 is positioned at the intersection of biochemistry and medicine, aiming to elucidate its fundamental biological roles while exploring novel avenues for therapeutic intervention in disease contexts related to calcium signaling.
