Cat: PA1000-2604

Recombinant Human QTRTD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    QTRTD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    QTRT2;QTRTD1;Queuine tRNA-ribosyltransferase accessory subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H974

  • Expression Region

    1-415aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMKLSLTKVVNGCRLGKIKNLGKTGDHT MDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEY KEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAGRVEMTVS KFMAIQKALQPDWFQCLSDGEVSCKEATSIKRVRKSVDRSLLFLDNCLRL QEESEVLQKSVIIGVIEGGDVMEERLRSARETAKRPVGGFLLDGFQGNPT TLEARLRLLSSVTAELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPY QVTERGCALTFSFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQE ITSFEINLKEKKYQEDFNPLVRGCSCYCCKNHTRAYIHHLLVTNELLAGV LLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

QTRTD1, or "QTRTD1 protein," is a relatively novel protein that has garnered attention in the field of molecular biology due to its potential implications in various physiological processes and disease states. Understanding the function and mechanisms of QTRTD1 is crucial, as emerging research suggests it may play a pivotal role in cellular signaling pathways and developmental regulation. Studies indicate that this protein could be associated with processes like cell differentiation, proliferation, and apoptosis, making it a potential biomarker for certain diseases, including cancer and developmental disorders. The reconstitution of QTRTD1 into recombinant forms has facilitated in-depth studies on its structural properties and interactions with other cellular molecules. By using various expression systems, researchers aim to elucidate the functional domains of QTRTD1, explore its binding partners, and investigate its downstream effects on cellular processes. As researchers continue to dissect the biochemical pathways involving QTRTD1, there's a growing interest in its therapeutic potential, which could open new avenues for targeted therapies in diseases where QTRTD1 is implicated. Overall, the investigation of QTRTD1 not only enhances our understanding of fundamental biological processes but also holds promise for advancing medical research and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US