Analytical Data
-
Gene name
MS4A3
- Application
-
Alternative Names
MS4A3; CD20L; HTM4; Membrane-spanning 4-domains subfamily A member 3; CD20 antigen-like protein; Hematopoietic-specific transmembrane protein 4; HTm4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96HJ5
-
Expression Region
1-214 aa
-
AA Sequence
MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAA MILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQN SFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLIL TLLELCVTISTIAMWCNANCCNSREEISSPPNSV
-
Molecular Weight
22.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MS4A3 (Membrane-Spanning 4-Domains Subfamily A Member 3) is a member of the MS4A gene family, which includes a group of proteins known for their roles in immune response and cell signaling. Investigating MS4A3 has gained attention due to its potential involvement in various physiological and pathological processes, particularly in the context of immune system function and inflammatory responses. Research has indicated that MS4A3 may be implicated in the pathogenesis of autoimmune diseases, such as multiple sclerosis and systemic lupus erythematosus, where altered expression of MS4A proteins is often observed. Understanding the structure and function of MS4A3, including the development of recombinant protein forms, can provide insights into its biological role and mechanisms of action. This could facilitate the identification of novel therapeutic targets and biomarkers for disease diagnosis and progression. Additionally, recombinant MS4A3 proteins can be used in functional assays to elucidate their interactions with other immune cells and signaling pathways. Overall, the study of MS4A3 and its recombinant forms holds promise for advancing our understanding of immune regulation and developing innovative strategies for managing immune-related disorders.
