Analytical Data
-
Gene name
PSME2
- Application
-
Alternative Names
PSME2;Proteasome activator complex subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UL46
-
Expression Region
1- 239aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAKPCGVRLSGEARKQVEVFRQNLFQEAEE FLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMET DKQEKKEVPKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIP KIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNP KGEEKPSMY
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSME2, or proteasome activator subunit 2, is a key component of the 26S proteasome, a multi-catalytic protein complex that plays a vital role in the degradation of ubiquitinated proteins, thereby regulating various cellular processes such as the cell cycle, apoptosis, and immune responses. Research into PSME2 has garnered attention due to its involvement in various diseases, including cancer and autoimmune disorders, where it may influence tumor progression and the inflammatory response. Studies have shown that PSME2 can enhance the activity of the proteasome, which is essential for maintaining protein homeostasis and cellular function. Understanding the structure and function of PSME2 is crucial, as it may reveal potential therapeutic targets for enhancing proteasome activity in diseases characterized by protein aggregation or misfolding. Furthermore, PSME2's interaction with other proteasome components and regulatory proteins may provide insights into the complex mechanisms of proteasome regulation. As a result, the recombinant expression and characterization of PSME2 have become critical in elucidating its role in proteasomal function and disease pathology, paving the way for novel interventions that exploit this protein's regulatory capabilities.











