Analytical Data
-
Gene name
IL6
- Application
-
Alternative Names
IL6；IFNB2；Interleukin-6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05231
-
Expression Region
1-212aa
-
AA Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
-
Molecular Weight
23.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-6 (IL-6) is a multifunctional cytokine that plays a crucial role in immune response, inflammation, and hematopoiesis. It is produced by various cells, including T cells, B cells, macrophages, and fibroblasts, and has been implicated in several pathological conditions, such as autoimmune diseases, cancer, and chronic inflammatory disorders. Due to its significant role in disease processes, IL-6 has attracted considerable attention for therapeutic intervention. Recombinant IL-6 proteins have been developed for research and clinical applications, enabling scientists to study the precise mechanisms of IL-6 signaling and its effects on target cells. These recombinant proteins also serve as potential therapeutic agents, particularly in conditions where IL-6 is dysregulated. The availability of high-purity, biologically active IL-6 has facilitated advances in understanding its role in both health and disease, reinforcing its status as a key target for drug development and a biomarker for disease progression. By elucidating the pathways involving IL-6, researchers aim to develop targeted therapies that can modulate its activity, providing new options for treating various inflammatory and immune-related conditions. Overall, the study of recombinant IL-6 protein is pivotal in the context of both basic research and clinical applications, fostering progress in the management of diseases associated with IL-6 dysregulation.
