Cat: PA2000-5236

Recombinant Human csgC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    csgC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    csgC;agfC;orfC;Curli assembly Protein CsgC

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52107

  • Expression Region

    9-110aa

  • AA Sequence

    ALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEKTLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS

  • Molecular Weight

    17.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

csgC is a gene associated with the production of curli fibers, which are a type of amyloid fiber involved in biofilm formation in various bacteria, particularly in Escherichia coli. These fibers play a crucial role in microbial adhesion and can significantly influence bacterial pathogenicity and environmental resilience. Recent studies have highlighted the importance of understanding the structure and function of csgC and its encoded proteins, as they are pivotal in the biogenesis of curli fibers. Research on csgC recombinant proteins has gained momentum due to their potential applications in biotechnology and medicine, including the development of biosensors, vaccines, and therapeutic agents. By studying the recombinant CsgC protein, researchers aim to elucidate the molecular mechanisms governing curli assembly and its interactions with host tissues. Moreover, insights into the role of csgC in biofilm development can provide valuable information for strategies to manage biofilm-related infections and improve industrial processes that rely on microbial aggregates. Understanding the recombinant CsgC protein's stability, folding, and interactions is essential for harnessing its properties for various applications, making it a focal point of ongoing microbiological and biochemical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US