Analytical Data
-
Gene name
catD
- Application
-
Alternative Names
catD；CPSD；Cathepsin D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11504
-
Expression Region
1-212aa
-
AA Sequence
MVFEKIDKNSWNRKEYFDHYFASVPCTYSMTVKVDITQIKEKGMKLYPAMLYYIAMIVNRHSEFRTAINQDGELGIYDEMIPSYTIFHNDTETFSSLWTECKSDFKSFLADYESDTQRYGNNHRMEGKPNAPENIFNVSMIPWSTFDGFNLNLQKGYDYLIPIFTMGKIIKKDNKIILPLAIQVHHAVCDGFHICRFVNELQELIIVTQVCL
-
Molecular Weight
32.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CatD, or Cathepsin D, is an aspartic protease that plays a crucial role in various physiological and pathological processes, including protein degradation, antigen processing, and apoptosis. Originally identified for its involvement in lysosomal function, CatD has gained attention for its implications in cancer biology, as its overexpression is often associated with tumor progression and metastasis. Research has shown that CatD contributes to the degradation of the extracellular matrix, facilitating cancer cell invasion and migration. Additionally, its role in the immune response highlights its importance in modulating inflammatory processes. The study of recombinant CatD proteins has provided insights into its structure-function relationships and potential therapeutic applications, including the development of inhibitors targeting its proteolytic activity. These inhibitors could serve as novel anticancer agents, making CatD a significant focus in both basic and translational research. Understanding the dynamics of CatD, including its regulation and interactions with other cellular components, continues to be a key area of interest, as it offers potential avenues for innovative treatments in cancer and other diseases where dysregulation of proteolytic activity is observed.
