Analytical Data
-
Gene name
MRGPRD
- Application
-
Alternative Names
Beta-alanine receptor;G-protein coupled receptor TGR7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDS7
-
Expression Region
1-321 aa
-
AA Sequence
MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The MRGPRD protein, a member of the Mas-related G protein-coupled receptor (GPCR) family, has garnered considerable interest in research due to its significant role in pain sensing and itch perception. Identified primarily in sensory neurons, MRGPRD appears to be involved in the modulation of pain signals and is implicated in various inflammatory responses. Its activation can lead to the release of pro-inflammatory mediators, suggesting a crucial function in the pathophysiology of chronic pain and allergic reactions. Recent studies have explored the receptor's signaling mechanisms, revealing potential pathways that could be targeted for therapeutic interventions in pain management and itch relief. Additionally, the reconstitution of MRGPRD in heterologous systems has provided insights into its pharmacological properties, aiding in the identification of selective ligands. Given the receptor's unique expression profile and functional characteristics, MRGPRD represents a promising target for novel drug development aimed at alleviating conditions associated with chronic pain and pruritus, thereby highlighting its relevance in both basic research and clinical applications.
