Analytical Data
-
Gene name
MORG1
- Application
-
Alternative Names
WD repeat domain-containing protein 83. Mitogen-activated protein kinase organizer 1. MAPK organizer 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRX9
-
Expression Region
1-315 aa
-
AA Sequence
MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG
-
Molecular Weight
60.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MORG1, or "MOR-G1," is a protein that has gained attention in recent years for its role in various cellular processes, particularly in the context of cell signaling and cytoskeletal dynamics. Research has shown that MORG1 is a crucial regulator of the actin cytoskeleton, which is essential for maintaining cell shape, motility, and division. It interacts with key signaling molecules and participates in pathways that modulate the cellular response to external stimuli. The study of MORG1 has significant implications in understanding normal cellular functions as well as pathological conditions, such as cancer metastasis and developmental disorders. By investigating MORG1's structure, function, and interactions, researchers aim to elucidate its precise role in cellular mechanisms and its potential as a therapeutic target. This protein's involvement in key signaling pathways also highlights its relevance in various diseases, making MORG1 a compelling subject for further research in cell biology and therapeutic development.











