Analytical Data
-
Gene name
Ab1-40
- Application
-
Alternative Names
Ab1-40；Small ribosomal subunit Protein uS2m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y399
-
Expression Region
1-296aa
-
AA Sequence
MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL
-
Molecular Weight
33.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ab1-40 is a peptide derived from amyloid precursor protein (APP) and is one of the main constituents of amyloid plaques commonly found in the brains of Alzheimer's disease patients. The study of Ab1-40 recombinant protein has gained significant attention due to its pivotal role in the pathogenesis of Alzheimer's disease, characterized by neurodegeneration and cognitive decline. Understanding the aggregation and toxicity of this peptide is crucial for developing therapeutic strategies aimed at mitigating Alzheimer's disease symptoms or slowing its progression. Researchers have focused on producing Ab1-40 in a recombinant form to study its biological properties, including aggregation kinetics, structure, and interactions with other cellular components. By systematically investigating these aspects, scientists hope to uncover the molecular mechanisms through which Ab1-40 contributes to neurotoxicity and to identify potential pharmacological targets that could prevent or reverse the formation of amyloid plaques. Additionally, recombinant Ab1-40 provides a standardized model for screening compounds that may inhibit its aggregation or promote its clearance, representing a promising avenue for drug development in the fight against Alzheimer's disease. Through advances in biotechnology, the ability to generate large quantities of this peptide has facilitated a deeper understanding of its role in Alzheimer's pathology, fostering the exploration of innovative therapeutic interventions.
