Analytical Data
-
Gene name
CDKN2B
- Application
-
Alternative Names
CDKN2B；MTS2；Cyclin-dependent kinase 4 inhibitor B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42772
-
Expression Region
1-138aa
-
AA Sequence
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
-
Molecular Weight
19.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDKN2B, also known as p15INK4b, plays a crucial role in regulating the cell cycle by inhibiting cyclin-dependent kinases, thereby controlling cellular proliferation and tumorigenesis. Abnormal expression or mutation of the CDKN2B gene has been associated with various cancers, including melanoma and pancreatic cancer, highlighting its significance as a potential biomarker and therapeutic target. The study of CDKN2B recombinant protein has garnered attention due to its potential application in elucidating the molecular mechanisms underlying its tumor-suppressive functions. Researchers aim to produce and purify CDKN2B recombinant protein to investigate its interactions with other cell cycle regulators and signaling pathways. This research could provide insights into the therapeutic potential of targeting CDKN2B-related pathways in cancer treatment, ultimately contributing to the development of novel strategies for early diagnosis and interventions in malignancies associated with its dysregulation. By understanding the structure and function of CDKN2B, scientists can explore its role in cellular senescence and tumor suppression, paving the way for innovative approaches to combat cancer through modulation of this critical regulatory pathway.
