Analytical Data
-
Gene name
PPIL3
- Application
-
Alternative Names
PPIL3;Peptidyl-prolyl cis-trans isomerase-like 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2H8
-
Expression Region
1-161aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCERTPKTCENFLA LCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDE LEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPIL3, or peptidyl-prolyl isomerase-like 3, is a member of the cyclophilin family of proteins, which are known for their role in catalyzing the cis-trans isomerization of proline residues in polypeptides. This post-translational modification is crucial for protein folding and function, affecting various cellular processes. Recent studies have highlighted the importance of PPIL3 in regulating cellular signaling pathways, particularly those related to inflammation and apoptosis. Research has indicated that PPIL3 may play a role in cancer progression and response to therapies, making it a potential biomarker and therapeutic target. Additionally, understanding PPIL3's structure and function through recombinant protein studies can provide insights into its mechanistic roles in diseases. The development of PPIL3 recombinant proteins allows for detailed biochemical analyses, structure-function studies, and the potential for high-throughput screening for inhibitors, which could lead to novel therapeutic strategies. Overall, the exploration of PPIL3 as a recombinant protein is pivotal for unveiling its biological significance and therapeutic potential in various diseases, particularly in oncology and inflammatory conditions.
