Cat: PA2000-876DB

Recombinant Human CDK18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CDK18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDK18;PCTAIRE3;PCTK3;Cyclin-dependent kinase 18

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q07002

  • Expression Region

    1-472aa

  • AA Sequence

    MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGR DPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMD IRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGE GTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANI VTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRG LAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVV TLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHL IFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLL SSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKD PGYRGLAFQQPGRGKNRRQSIF

  • Molecular Weight

    76 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CDK18, a member of the cyclin-dependent kinase (CDK) family, plays a crucial role in the regulation of the cell cycle and transcription processes. Its involvement in various cellular functions has drawn attention to its potential implications in cancer and other diseases. Previous studies have indicated that CDK18 is implicated in modulating the activity of transcription factors and influencing RNA polymerase II function, thereby affecting gene expression. Research has also shown that CDK18 interacts with various cellular pathways, including those related to cell proliferation, DNA repair, and stress responses. The understanding of CDK18's role has been enhanced by advances in recombinant protein technology, allowing for the production of large quantities of the protein for detailed biochemical and biophysical characterization. Investigating the structure, dynamics, and interactions of CDK18 through recombinant protein studies can reveal insights into its functional mechanisms and regulatory pathways. Furthermore, given its involvement in oncogenic processes, CDK18 could represent a potential therapeutic target, making the exploration of its recombinant protein not only significant for basic research but also for future drug development strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US