Analytical Data
-
Gene name
PPCS
- Application
-
Alternative Names
PPCS;COAB;Phosphopantothenate--cysteine ligase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HAB8
-
Expression Region
1-331aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAEMDPVAEFPQPPGAARWAEVMARFAARL GAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGV LFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAE ALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLL SEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPCS (Protoporphyrinogen IX Oxidase) is an enzyme crucial in the heme biosynthesis pathway, catalyzing the conversion of protoporphyrinogen IX to protoporphyrin IX, a key precursor in the formation of heme. The study of PPCS has garnered interest due to its significant role in various biological processes, including oxygen transport, electron transport, and drug metabolism. Mutations in the PPCS gene have been linked to disorders such as porphyrias, which can lead to neurological and dermatological symptoms. Moreover, understanding the structure and function of PPCS is vital for potential therapeutic applications, particularly in designing inhibitors that could serve as treatments for diseases associated with heme metabolism dysregulation. Advances in recombinant protein technology have enabled the expression and purification of PPCS, facilitating in-depth biochemical and biophysical studies. These studies not only enhance our understanding of PPCS’s enzymatic mechanism but also pave the way for investigating its role in disease. Furthermore, the exploration of PPCS-functionalized biomaterials holds promise for biomedical applications, including targeted drug delivery systems and tissue engineering. Overall, the research on PPCS recombinant proteins continues to provide insights into fundamental biochemical pathways and offers potential for therapeutic innovation.
