Cat: PA1000-2471

Recombinant Human PPCS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPCS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPCS;COAB;Phosphopantothenate--cysteine ligase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HAB8

  • Expression Region

    1-331aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAEMDPVAEFPQPPGAARWAEVMARFAARL GAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGV LFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAE ALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLL SEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPCS (Protoporphyrinogen IX Oxidase) is an enzyme crucial in the heme biosynthesis pathway, catalyzing the conversion of protoporphyrinogen IX to protoporphyrin IX, a key precursor in the formation of heme. The study of PPCS has garnered interest due to its significant role in various biological processes, including oxygen transport, electron transport, and drug metabolism. Mutations in the PPCS gene have been linked to disorders such as porphyrias, which can lead to neurological and dermatological symptoms. Moreover, understanding the structure and function of PPCS is vital for potential therapeutic applications, particularly in designing inhibitors that could serve as treatments for diseases associated with heme metabolism dysregulation. Advances in recombinant protein technology have enabled the expression and purification of PPCS, facilitating in-depth biochemical and biophysical studies. These studies not only enhance our understanding of PPCS’s enzymatic mechanism but also pave the way for investigating its role in disease. Furthermore, the exploration of PPCS-functionalized biomaterials holds promise for biomedical applications, including targeted drug delivery systems and tissue engineering. Overall, the research on PPCS recombinant proteins continues to provide insights into fundamental biochemical pathways and offers potential for therapeutic innovation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US