Analytical Data
-
Gene name
MLL2
- Application
-
Alternative Names
AAD10; ALL1 related gene; ALL1-related protein; ALR; CAGL114; Histone-lysine N-methyltransferase MLL2; KABUK1; Kabuki make up syndrome; Kabuki mental retardation syndrome; KMS; KMT2B; KMT2D; Lysine N methyltransferase 2D; Lysine N-methyltransferase 2B; MLL2; MLL2_HUMAN; MLL4; Myeloid/lymphoid or mixed lineage leukemia 2; Myeloid/lymphoid or mixed-lineage leukemia protein 2; TNRC21; Trinucleotide repeat containing 21
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14686
-
Expression Region
1487-1586 aa
-
AA Sequence
SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MLL2, also known as KMT2D, is a member of the mixed-lineage leukemia (MLL) family of genes that encode histone methyltransferases, which play a crucial role in gene regulation and chromatin remodeling. Abnormalities in MLL2 have been implicated in various cancers and developmental disorders, particularly in pediatric acute lymphoblastic leukemia and Kabuki syndrome, making it a significant focus of research. This protein primarily functions by tri-methylating histone H3 at lysine 4 (H3K4me3), which is associated with active transcription and the regulation of numerous downstream genes essential for cellular differentiation and growth. Recent studies have highlighted the interactions of MLL2 with various other proteins and its regulatory networks, suggesting that its dysregulation could lead to oncogenic transformations. The generation of recombinant MLL2 protein allows for a better understanding of its biochemical properties, enzymatic activity, and structural characteristics, facilitating the exploration of its role in cancer biology and epigenetic regulation. Furthermore, studying MLL2 in a controlled system can help identify potential therapeutic targets for overcoming MLL2-related malignancies, offering new avenues for treatment strategies. As the field of epigenetics advances, elucidating the functions and mechanisms of MLL2 will be vital for understanding its contribution to cellular processes and disease pathogenesis.
