Analytical Data
-
Gene name
Rbck1
- Application
-
Alternative Names
Rbck1；Iron-responsive element-binding Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYM8
-
Expression Region
1-510aa
-
AA Sequence
MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
-
Molecular Weight
58.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Rbck1 (RING finger and BK-type PHD-finger domain-containing protein 1) is an E3 ubiquitin ligase that plays a crucial role in regulating various cellular processes, including protein degradation, signal transduction, and immune responses. Its ability to tag substrates for proteasomal degradation is essential for maintaining cellular homeostasis and responding to stress conditions. Research has indicated that Rbck1 is involved in several pathological conditions, including cancer, neurodegenerative diseases, and immune disorders, highlighting its potential as a therapeutic target. The study of Rbck1 recombinant proteins is essential for elucidating its molecular mechanisms and interactions with other cellular components. By producing and characterizing Rbck1 in a recombinant form, researchers aim to explore its enzymatic activity, substrate specificity, and the impact of post-translational modifications on its function. Understanding Rbck1's role in ubiquitination pathways may reveal novel insights into disease mechanisms and pave the way for the development of targeted interventions. As such, Rbck1 is emerging as a significant focus in the field of molecular biology and therapeutic research, with potential implications for advancing treatment strategies for diseases associated with dysregulated protein homeostasis.
