Cat: PA2000-9336

Recombinant Human MGC4836 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MGC4836

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RNA-directed DNA polymerase. EC:2.7.7.49

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6PID2

  • Expression Region

    1-328 aa

  • AA Sequence

    MLKTLNKLGIDGTYFKIIRAVYDKPTANITLNGQKLKAFPLKTGTTHGCPVSPLLFNIVLEVLATAIRQEKEIKGIQLGKEEVKLSLFADDMIVYLENPIASAQNLLKLISNFSKVSGYKINVQKSQAFLYTNNRQTESQIMSELSFTIASKRIKYLGIQLTRDVKDLFKENYKPLLKEIKEDTNKWKKSPCSWTGRINIVKMAILPKVIYKFNAIPIKLSMTFFTELEKSTLKFIWNQKRAHIAKSILSQKNKAGGIMLPDFKLYHKATVIKTAWYWYQNRDIDQRNRTEPSEIMPHIYNYLIFDKTDKNKQWGKDSLFNKWCWENG

  • Molecular Weight

    64.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MGC4836 is a recombinant protein derived from the mouse genome, specifically designed to study gene function and protein interactions. This protein is part of a broader initiative to understand the molecular mechanisms underlying various biological processes, including cell signaling, development, and disease pathology. The research surrounding MGC4836 is significant because it helps to elucidate the roles of specific genes in these processes, offering insights into potential therapeutic targets for diseases. Recombinant proteins like MGC4836 are produced through genetic engineering techniques, allowing for large-scale production and enhanced study of their biochemical properties. Investigators utilize MGC4836 in various assays, such as binding studies, to determine its interaction with other proteins or molecules, which can reveal crucial information about cellular pathways. Additionally, studying MGC4836 contributes to the field of structural biology, as the protein's three-dimensional structure can be analyzed to uncover functional sites and mechanisms of action. Overall, the exploration of MGC4836 is a vital part of advancing our understanding of genetics and protein functionality, with significant implications for drug development and therapeutic strategies aimed at various conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US