Analytical Data
-
Gene name
yfbU
- Application
-
Alternative Names
yfbU；UPF0304 Protein YfbU
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A8W9
-
Expression Region
1-164aa
-
AA Sequence
MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA
-
Molecular Weight
67.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YfbU is a protein encoded by the yfbU gene, prevalent in various bacterial species, including Escherichia coli. Research into YfbU has gained prominence due to its unexplored functions and potential implications in bacterial physiology. Structurally, YfbU contains domains that suggest its involvement in various biological processes, possibly related to stress response and cellular metabolism. Preliminary studies indicate that YfbU may play a role in the synthesis of polysaccharides, contributing to the bacterial cell envelope's integrity and functionality. Additionally, its expression is believed to be regulated under certain environmental stresses, thereby hinting at a role in the adaptive mechanisms of bacteria. The investigation of YfbU is particularly significant in the context of antibiotic resistance and bacterial virulence, as understanding its function could open new avenues for therapeutic targets. Researchers are employing various biochemical and genetic approaches to elucidate the precise roles of YfbU, including its interactions with other cellular components. Insights gained from these studies could enhance our understanding of bacterial adaptability and resilience, ultimately contributing to the development of novel antimicrobial strategies.
