Analytical Data
-
Gene name
MEF2B
- Application
-
Alternative Names
MEF2B, XMEF2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FH0
-
Expression Region
1-119aa
-
AA Sequence
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA
-
Molecular Weight
38.83 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MEF2B (Myocyte Enhancer Factor 2B) is a member of the MEF2 family of transcription factors, which play crucial roles in regulating gene expression during development, particularly in muscle and cardiac tissues. Research on MEF2B has gained attention due to its significant implications in various biological processes, including cell differentiation, proliferation, and apoptosis. The protein is involved in the regulation of neuronal cell functions, and alterations in its expression have been associated with neurodegenerative diseases and various forms of cancer. Recent studies have highlighted the importance of MEF2B in cardiac health, linking its dysregulation to heart diseases such as cardiomyopathy. Given its critical role in these pathways, generating and characterizing recombinant MEF2B protein is essential for further elucidating its mechanisms of action and functional interactions at the molecular level. Additionally, recombinant MEF2B can be utilized in biochemical assays to screen for potential therapeutic compounds that may modulate its activity. Overall, the study of MEF2B as a recombinant protein presents significant opportunities for advancing our understanding of its biological roles and therapeutic targeting in diseases involving muscle and neuronal systems.
