Analytical Data
-
Gene name
TBP1
- Application
-
Alternative Names
TBP1；TBP1；26S proteasome regulatory subunit 6A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28147
-
Expression Region
1-200aa
-
AA Sequence
MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TBP1, or TATA-binding protein 1, is a critical component of the transcription initiation machinery in eukaryotic cells, playing a fundamental role in the formation of the pre-initiation complex required for RNA polymerase II-mediated transcription. Research has indicated that TBP1 is not only essential for the expression of protein-coding genes but also influences the regulation of various non-coding RNAs, which are pivotal in cellular processes such as development, differentiation, and response to environmental stimuli. Dysregulation of TBP1 has been implicated in several diseases, including cancer and neurodegenerative disorders, highlighting its significance in maintaining cellular homeostasis. The study of TBP1 recombinant proteins has gained traction as a means to elucidate its functional mechanisms, understand its interactions with other transcription factors, and explore its potential as a therapeutic target. Recombination techniques allow for the expression of TBP1 in heterologous systems, facilitating the investigation of its biochemical properties and functional roles, providing insights into the complexities of gene regulation. Consequently, the research surrounding TBP1 recombinant proteins is crucial for advancing our understanding of transcriptional regulation and the broader implications of TBP1 in health and disease.
