Cat: PA1000-2319

Recombinant Human PDIA4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDIA4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PDIA4;ERP70;ERP72;Protein disulfide-isomerase A4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13667

  • Expression Region

    21-645aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMVAGAEGPDEDSSNRENAIEDEEEEEEEDD DEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAP EYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV DYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILV EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDV SGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEF LKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLK VSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGH RKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYT FAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLR EFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIE FYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEG FPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PDIA4 (Protein Disulfide Isomerase Family A Member 4) is a key enzyme involved in the formation and rearrangement of disulfide bonds in proteins, playing a critical role in protein folding and quality control within the endoplasmic reticulum. Emerging evidence suggests that PDIA4 is not only essential for maintaining cellular homeostasis but also has significant implications in various diseases, including cancer, neurodegenerative disorders, and autoimmune conditions. In cancer biology, PDIA4 has been associated with the development of drug resistance and tumor progression, leading to increased interest in targeting this protein for therapeutic interventions. Recent studies have also highlighted its potential role in modulating the immune response, making it a candidate for autoimmune disease research. Moreover, the exploration of PDIA4 as a biomarker for disease progression and prognosis is gaining traction. Given its multifaceted functions, the recombinant production of PDIA4 has become a focus for researchers seeking to understand its biochemical properties and interactions. By studying the structural and functional aspects of PDIA4, scientists aim to develop novel therapeutic strategies that could leverage its role in disease modulation. A deeper understanding of this enzyme could pave the way for innovative treatments that enhance protein folding mechanisms, correct misfolded proteins, or even disrupt the pathways involved in disease progression. Therefore, the investigation of PDIA4 and its recombinant forms represents an exciting frontier in biomedical research, with the potential to unlock new avenues for intervention in a variety of pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US