Analytical Data
-
Gene name
MCAT
- Application
-
Alternative Names
FabD; FABD_HUMAN; FASN 2C; FASN2C; Malonyl CoA acyl carrier protein transacylase; Malonyl CoA acyl carrier protein transacylase mitochondrial; Malonyl CoA:ACP acyltransferase (mitochondrial); Malonyl CoA:ACP acyltransferase; Malonyl CoA:acyl carrier protein transacylase mitochondrial; Malonyl-CoA-acyl carrier protein transacylase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IVS2
-
Expression Region
1-180aa
-
AA Sequence
MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL
-
Molecular Weight
45.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of MCAT (Mitochondrial Catabolic Tissues) recombinant proteins has gained significant attention in the field of molecular biology and biomedicine. MCAT plays a crucial role in mitochondrial metabolism, particularly in the oxidative breakdown of fatty acids, which is vital for energy production in cells. Research indicates that recombinant proteins derived from MCAT can be engineered to enhance metabolic pathways, potentially leading to innovative approaches in treating metabolic disorders, obesity, and mitochondrial dysfunction. The application of recombinant DNA technology allows for the cloning and expression of the MCAT gene in various host systems, facilitating large-scale production and functional characterization of the protein. Understanding the structural and functional properties of MCAT recombinant proteins can provide insights into their enzymatic mechanisms and regulatory pathways. Furthermore, studies exploring the interactions between MCAT and other metabolic enzymes or pathways are essential for deciphering the complex network of cellular respiration and energy balance. The implications of this research extend to developing therapeutic strategies aimed at enhancing mitochondrial function, thereby improving health outcomes in various diseases linked to energy metabolism. In sum, the investigation of MCAT recombinant proteins not only contributes to the fundamental understanding of mitochondrial biology but also opens new avenues for clinical applications in metabolic health and disease management.
