Cat: PA1000-2293

Recombinant Human PCBP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PCBP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PCBP1;Poly(rC)-binding Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15365

  • Expression Region

    1-163aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMDAGVTESGLNVTLTIRLLMHGKEVGS IIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIID KLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIREST GAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQIC

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PCBP1 (Poly(RC) Binding Protein 1) is a ribonucleoprotein that plays essential roles in regulating RNA metabolism, including mRNA stability, translation, and localization. As a member of the poly(rC) binding proteins family, PCBP1 is implicated in various cellular processes and has been associated with different diseases, including cancer and viral infections. Researchers have increasingly focused on PCBP1 due to its critical involvement in post-transcriptional gene regulation and its potential as a therapeutic target. Recombinant PCBP1 protein has been produced for in-depth studies to elucidate its structure-function relationships, interactions with RNA and other proteins, and its role in cellular pathways. By using recombinant techniques, scientists can obtain large quantities of purified PCBP1, facilitating biophysical assays, structural analyses, and functional studies. Understanding PCBP1's mechanisms may provide insights into its contribution to disease pathogenesis and help identify novel approaches for treatment, highlighting the importance of PCBP1 in molecular biology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US