Analytical Data
-
Gene name
PCBP1
- Application
-
Alternative Names
PCBP1;Poly(rC)-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15365
-
Expression Region
1-163aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMDAGVTESGLNVTLTIRLLMHGKEVGS IIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIID KLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIREST GAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQIC
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PCBP1 (Poly(RC) Binding Protein 1) is a ribonucleoprotein that plays essential roles in regulating RNA metabolism, including mRNA stability, translation, and localization. As a member of the poly(rC) binding proteins family, PCBP1 is implicated in various cellular processes and has been associated with different diseases, including cancer and viral infections. Researchers have increasingly focused on PCBP1 due to its critical involvement in post-transcriptional gene regulation and its potential as a therapeutic target. Recombinant PCBP1 protein has been produced for in-depth studies to elucidate its structure-function relationships, interactions with RNA and other proteins, and its role in cellular pathways. By using recombinant techniques, scientists can obtain large quantities of purified PCBP1, facilitating biophysical assays, structural analyses, and functional studies. Understanding PCBP1's mechanisms may provide insights into its contribution to disease pathogenesis and help identify novel approaches for treatment, highlighting the importance of PCBP1 in molecular biology and therapeutic development.











