Analytical Data
-
Gene name
MARVELD1
- Application
-
Alternative Names
MARVELD1; MRVLDC1; MARVEL domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BSK0
-
Expression Region
1-173aa
-
AA Sequence
MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA
-
Molecular Weight
45.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MARVELD1 is a protein that belongs to the MARVEL (MAvs, Receptor associated with a MVe, and ER lipid raft) domain-containing protein family. It has garnered significant attention due to its potential roles in various cellular processes, including membrane dynamics, signal transduction, and the regulation of cell cycle. Researchers have identified MARVELD1 as a key player in maintaining the integrity of cell membranes and facilitating intracellular signaling pathways. Dysregulation of MARVELD1 expression has been associated with various pathological conditions, including cancer, where it may influence tumor growth and metastasis. Furthermore, there is emerging evidence that MARVELD1 interacts with several important signaling molecules, indicating its role in modulating various physiological responses. Studies focusing on the recombinant production of MARVELD1 protein have aimed to elucidate its structural and functional characteristics, which may provide insights into its biological functions and potential therapeutic targets. Given the complexity of its mechanisms, ongoing research continues to explore the implications of MARVELD1 in health and disease, highlighting its importance in the broader context of molecular and cellular biology. Understanding MARVELD1's role may not only enhance our knowledge of cell biology but also offer novel approaches for the development of targeted therapies in diseases where MARVELD1 is implicated.
