Analytical Data
-
Gene name
MAP4K4
- Application
-
Alternative Names
FLH21957; FLJ10410; FLJ20373; FLJ90111; Hepatocyte progenitor kinase like/germinal center kinase like kinase; HGK; HPK/GCK like kinase; HPK/GCK like kinase HGK; HPK/GCK-like kinase HGK; KIAA0687; M4K4_HUMAN; MAP4K4; MAPK/ERK kinase kinase kinase 4; MEK kinase kinase 4; MEKKK 4; MEKKK4; Mitogen activated protein kinase kinase kinase kinase 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95819
-
Expression Region
25-289aa
-
AA Sequence
FELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFI
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP4K4, a member of the mitogen-activated protein kinase (MAPK) kinase kinase family, has gained significant attention in recent years due to its pivotal role in various cellular processes, including cell proliferation, differentiation, and apoptosis. Research has revealed that MAP4K4 is involved in multiple signaling pathways, particularly those related to stress response and inflammatory processes. Its overexpression has been linked to several diseases, notably cancer, where it may contribute to tumor growth and metastasis by influencing the epithelial-mesenchymal transition and enhancing cellular motility. Furthermore, MAP4K4 has been implicated in metabolic disorders, underscoring its relevance beyond oncology. Given its critical functions, MAP4K4 presents a promising target for therapeutic intervention. Researchers have initiated studies on MAP4K4-derived recombinant proteins to better understand its biological activities and molecular mechanisms. These investigations aim to elucidate how MAP4K4 facilitates various signal transduction pathways and to explore the potential of MAP4K4 modulators in clinical settings. This research could pave the way for innovative treatments for diseases associated with MAP4K4 dysregulation, emphasizing its importance in both basic science and therapeutic development.
