Analytical Data
-
Gene name
PALM
- Application
-
Alternative Names
PALM;KIAA0270;Paralemmin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75781
-
Expression Region
1-384aa
-
AA Sequence
MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCC
-
Molecular Weight
45.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of PALM (Peptide-Activated Ligand-Mediated) recombinant proteins emerges from the need to understand and harness the intricate mechanisms of cellular signaling and molecular interactions. PALM proteins play a pivotal role in various biological processes, including cell differentiation, immune response, and neuronal communication. These proteins, often characterized by their ability to specifically bind to target peptides or ligands, provide valuable insights into receptor-ligand dynamics and their influence on cellular behavior. The advent of recombinant DNA technology has enabled researchers to produce PALM proteins in sufficient quantities for detailed biochemical analysis and functional assays. Additionally, the potential applications of PALM proteins in therapeutic contexts, such as drug delivery systems, targeted therapies, and vaccine development, make them a focal point of current biochemical research. Understanding the structural and functional properties of PALM proteins not only aids in the elucidation of fundamental biological processes but also paves the way for innovative solutions in biotechnology and medicine. As the scientific community continues to explore the diverse functionalities of PALM proteins, their applications could revolutionize approaches to disease treatment and prevention, highlighting the significance of this research area in advancing both basic and applied sciences.
