Analytical Data
-
Gene name
Car
- Application
-
Alternative Names
Car;CARMA3;Caspase recruitment domain-containing Protein 10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35243
-
Expression Region
2-200aa
-
AA Sequence
GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
-
Molecular Weight
25.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAR (Chimeric Antigen Receptor) protein engineering has emerged as a groundbreaking approach in cancer immunotherapy, particularly in the field of personalized medicine. The concept behind CARs is to genetically modify a patient's T cells to express receptors that specifically recognize and bind to antigens on cancer cells. This innovative strategy allows for enhanced targeting and destruction of tumors, overcoming some limitations of traditional therapies. Research into CAR proteins has significantly accelerated following the success of CAR T-cell therapies in treating hematological malignancies, leading to FDA approvals for several CAR T products. Current studies focus on optimizing CAR designs by exploring various antigen targets, improving T-cell persistence, and mitigating adverse effects such as cytokine release syndrome and neurotoxicity. Additionally, researchers are investigating the potential of CAR technology in solid tumors, which present unique challenges due to the tumor microenvironment. The ongoing quest to enhance CAR engineering aims to refine its efficacy and safety, paving the way for broader applications in oncology and possibly other diseases.











