Cat: PA2000-717DB

Recombinant Human a4GALT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    a4GALT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    a4GALT;A14GALT;A4GALT1;Lactosylceramide 4-alpha-galactosyltransferase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NPC4

  • Expression Region

    1-353aa

  • AA Sequence

    MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKG QLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVES AARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELF RDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKN LRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQG PQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDIN PEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMK MYL

  • Molecular Weight

    67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the A4GALT recombinant protein is centered on its role in glycosylation processes, particularly the transfer of galactose to the core structure of glycoproteins and glycolipids. A4GALT, or alpha-1,4-galactosyltransferase, is crucial in the synthesis of glycan structures that contribute to cellular communication, recognition, and immune response. Alterations or deficiencies in A4GALT can lead to various pathological conditions, including immune deficiencies and certain types of cancer, highlighting the importance of this enzyme in maintaining cellular homeostasis. Research into A4GALT recombinant protein aims to elucidate its biochemical properties, substrate specificity, and regulation mechanisms, which can further our understanding of glycosylation pathways. This knowledge not only contributes to basic biological science but also holds potential for therapeutic applications, such as the development of targeted treatments for conditions arising from glycosylation defects. Additionally, the production of A4GALT as a recombinant protein facilitates the exploration of its function in vivo, enabling scientists to study its interactions within complex biological systems. Overall, investigating A4GALT offers critical insights into the broader implications of glycosylation in health and disease, paving the way for novel intervention strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US