Analytical Data
-
Gene name
AGPAT4
- Application
-
Alternative Names
AGPAT4；1-acyl-sn-glycerol-3-phosphate acyltransferase delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRZ5
-
Expression Region
1-378aa
-
AA Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND
-
Molecular Weight
45.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AGPAT4, or 1-Acylglycerol-3-Phosphate O-acyltransferase 4, is a key enzyme involved in glycerolipid metabolism, particularly in the biosynthesis of phosphatidic acid, a crucial intermediate in lipid metabolism and cellular signaling. The study of AGPAT4 has gained importance due to its potential implications in metabolic disorders, obesity, and insulin resistance. Dysregulation of lipid metabolism is associated with various health issues, including type 2 diabetes and cardiovascular diseases. Research has shown that AGPAT4 influences adipocyte differentiation and lipid storage, highlighting its role in energy homeostasis. Furthermore, the investigation of AGPAT4 is critical for understanding the molecular mechanisms underlying lipid-related pathologies. Recombination and expression studies in model systems have revealed insights into AGPAT4's functional properties, substrate specificity, and interaction with other metabolic pathways. The generation of AGPAT4 recombinant proteins facilitates detailed biochemical and structural analyses, providing a platform for drug discovery and the development of therapeutic strategies to modulate lipid metabolism. Overall, the exploration of AGPAT4 as a therapeutic target underscores the enzyme’s significance in both basic research and clinical applications aimed at improving metabolic health.
