Cat: PA1000-2235

Recombinant Human OCIAD2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OCIAD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OCIAD2;OCIA domain-containing Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q56VL3

  • Expression Region

    1-154aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMASASARGNQDKDAHFPPPSKQSLLFC PKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAA NSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAGFGPQHN RHCLLTCEECKIKHGLSEKGDSQPSAS

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OCIAD2, or Ovarian Cancer ImmunoassociaTed Antigen 2, is a cancer-associated antigen initially identified in ovarian cancer research. Its role in tumor immunology has drawn interest due to its potential as a biomarker for early detection of ovarian cancer and its involvement in immune responses against tumors. The study of OCIAD2, especially its recombinant form, aims to elucidate its structure-function relationships and enhance our understanding of cancer immunology. Given that ovarian cancer often presents at advanced stages, identifying specific biomarkers like OCIAD2 could facilitate earlier diagnosis and targeted therapies. Recombinant OCIAD2 proteins are being designed for use in immunological assays and vaccine development, providing insights into T-cell responses and antibody production against tumor antigens. As researchers investigate the antigen's immunogenic properties, the goal is to develop novel therapeutic strategies that leverage the immune system to better target and eliminate ovarian cancer cells. This approach is part of a broader trend in oncology, focusing on personalized medicine and immunotherapy to improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US