Analytical Data
-
Gene name
OCIAD2
- Application
-
Alternative Names
OCIAD2;OCIA domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q56VL3
-
Expression Region
1-154aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMASASARGNQDKDAHFPPPSKQSLLFC PKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAA NSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAGFGPQHN RHCLLTCEECKIKHGLSEKGDSQPSAS
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OCIAD2, or Ovarian Cancer ImmunoassociaTed Antigen 2, is a cancer-associated antigen initially identified in ovarian cancer research. Its role in tumor immunology has drawn interest due to its potential as a biomarker for early detection of ovarian cancer and its involvement in immune responses against tumors. The study of OCIAD2, especially its recombinant form, aims to elucidate its structure-function relationships and enhance our understanding of cancer immunology. Given that ovarian cancer often presents at advanced stages, identifying specific biomarkers like OCIAD2 could facilitate earlier diagnosis and targeted therapies. Recombinant OCIAD2 proteins are being designed for use in immunological assays and vaccine development, providing insights into T-cell responses and antibody production against tumor antigens. As researchers investigate the antigen's immunogenic properties, the goal is to develop novel therapeutic strategies that leverage the immune system to better target and eliminate ovarian cancer cells. This approach is part of a broader trend in oncology, focusing on personalized medicine and immunotherapy to improve patient outcomes.











