Analytical Data
-
Gene name
At5g42100
- Application
-
Alternative Names
At5g42100；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9FHX5
-
Expression Region
27-425aa
-
AA Sequence
IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISSAGGKGRFVECVLFFFLLCIIKLRLKLLQPGR
-
Molecular Weight
71.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The At5g42100 gene from Arabidopsis thaliana encodes a protein of significant interest due to its potential roles in plant growth, development, and stress responses. As a model organism, Arabidopsis is widely used in plant molecular biology and genetics, providing insights into complex biological processes. The At5g42100 protein has been implicated in various metabolic pathways, influencing plant physiological responses to environmental stimuli. Studies have suggested that this protein may function in regulating gene expression or mediating signaling pathways, particularly in response to abiotic stressors such as drought or salinity. Understanding the structure and function of the At5g42100 protein could lead to advancements in crop biotechnology, potentially enhancing stress tolerance and improving yield in agricultural species. By characterizing this recombinant protein, researchers aim to uncover its biological activity and interactions within the plant system, thereby contributing to the broader understanding of plant responses to climate change and other environmental challenges. This line of research is critical as global food security continues to face pressures from changing environmental conditions, necessitating innovative approaches to sustainable agriculture.
