Analytical Data
-
Gene name
MACF1
- Application
-
Alternative Names
MACF1; ABP620; ACF7; KIAA0465; KIAA1251; Microtubule-actin cross-linking factor 1; isoforms 1/2/3/5; 620 kDa actin-binding protein; ABP620; Actin cross-linking family protein 7; Macrophin-1; Trabeculin-alpha
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PK2
-
Expression Region
1-95aa
-
AA Sequence
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
-
Molecular Weight
36.08 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MACF1, or Microtubule Actin Crosslinking Factor 1, is a cytoskeletal protein that plays a crucial role in maintaining cell structure and integrity by linking microtubules and actin filaments. This protein has garnered significant attention in recent years due to its involvement in various cellular processes, including cell migration, adhesion, and division. The dynamics of the cytoskeleton, mediated by MACF1, are essential for normal physiological functions and development. Disruptions in MACF1 expression or function have been implicated in several pathological conditions, including cancer metastasis and neurodegenerative diseases. Recent research has focused on understanding the molecular mechanisms by which MACF1 operates, including its interaction with other proteins and its regulation under different cellular contexts. Furthermore, studies utilizing recombinant MACF1 proteins aim to elucidate its specific roles and pathways in cytoskeletal organization, providing insights that could pave the way for targeted therapeutic interventions in diseases associated with cytoskeletal dysregulation. As the understanding of MACF1 continues to evolve, it holds promise as a potential biomarker for disease progression and a novel target for therapeutic strategies.
