Analytical Data
-
Gene name
NUTF2
- Application
-
Alternative Names
NUTF2;NTF2;Nuclear transport factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61970
-
Expression Region
1-127aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGDKPIWEQIGSSFIQHYYQLFDNDRTQLG AIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSC IISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUTF2, also known as Nuclear Transport Factor 2, is a crucial protein involved in the nuclear import of various proteins through its interaction with importin molecules. Research on NUTF2 has gained significance due to its essential role in cellular function, particularly in the regulation of gene expression and cell cycle progression. Dysregulation of nuclear transport mechanisms, where NUTF2 plays a pivotal role, is often linked to various diseases, including cancer and neurodegenerative disorders. The study of recombinant NUTF2 has become a focal point for understanding its structural and functional characteristics, as well as its interactions with other nuclear transport components. By producing and analyzing recombinant NUTF2, researchers aim to elucidate its binding dynamics, transport mechanisms, and potential implications in therapeutic strategies. The ability to generate purified forms of this protein allows for comprehensive biophysical studies and high-resolution structural analyses, contributing to a deeper understanding of nuclear transport pathways. This research not only enhances our knowledge of fundamental cellular processes but also opens avenues for developing targeted interventions in diseases associated with nuclear transport defects.
