Analytical Data
-
Gene name
NUDT2
- Application
-
Alternative Names
NUDT2;APAH1;Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50583
-
Expression Region
1-147aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMALRACGLIIFRRCLIPKVDNNAIEFLLLQ ASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKE MKAALQEGHQFLCSIEA
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUDT2, a member of the Nudix hydrolase family, has garnered increasing interest in biomedical research due to its potential roles in cellular stress responses and metabolic regulation. This protein plays a crucial function in hydrolyzing nucleoside diphosphate sugars, thereby influencing nucleotide pool balance and energy metabolism. Its involvement in processes such as nucleotide salvage, oxidative stress response, and cell signaling pathways underlines its significance in various biological contexts. Recent studies have suggested that NUDT2 may also be implicated in cancer biology, as altered expression levels of this enzyme could affect tumor proliferation and survival. Understanding the structure and function of NUDT2 is essential for elucidating its biological roles and potential therapeutic applications. Researchers are now focusing on the recombinant expression of NUDT2 to facilitate biochemical assays and structural studies, which could reveal insights into the enzyme's mechanism of action and regulatory functions in health and disease. This growing body of evidence emphasizes the importance of NUDT2 as a candidate for further exploration in the landscape of molecular biology and therapeutic interventions.
