Analytical Data
-
Gene name
LYSMD4
- Application
-
Alternative Names
LYSMD4LysM and putative peptidoglycan-binding domain-containing protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5XG99
-
Expression Region
1-297aa
-
AA Sequence
MAVGTRGTLLKKSLTVWFCGPGARSATRAVSTSLPRREQVTWCCCSGSWPRRTASTSWRCSMAANFCRHTVWLTEHGLKNEACPTKTGIDGVGFLVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS
-
Molecular Weight
58.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYSMD4 is a protein that plays a critical role in various cellular processes, including regulation of gene expression and response to stress. Its study has garnered interest due to its potential implications in understanding diseases related to immune response and inflammation. LYSMD4 is believed to be involved in the modulation of signaling pathways that affect cell survival and proliferation, which makes it a promising target for therapeutic interventions. Research has indicated that LYSMD4 may interact with key proteins in these pathways, influencing their activity and stability. Moreover, its expression patterns in different tissues suggest it may have specific functions in various biological contexts. As a result, researchers are increasingly focused on exploring the structure and function of LYSMD4, particularly through the production of recombinant LYSMD4 proteins for in vitro studies. These investigations aim to elucidate the molecular mechanisms underlying LYSMD4’s role in cellular processes and its potential link to pathological conditions, thereby contributing to a deeper understanding of immunological and inflammatory responses. Understanding LYSMD4 at a molecular level may pave the way for developing novel therapeutic strategies targeting diseases associated with its dysregulation.











