Analytical Data
-
Gene name
LYSMD3
- Application
-
Alternative Names
1110030H10Rik; BC003322; lysM and putative peptidoglycan binding domain containing protein 3; LysM and putative peptidoglycan-binding domain-containing protein 3; LYSM3_HUMAN; lysmd3; RGD1308805
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z3D4
-
Expression Region
1-127aa
-
AA Sequence
MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVYQNSSKKVQFLDRNTLSSKRKTDFTSFICSILFRTTGNFAS
-
Molecular Weight
40.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYSMD3 (Lysozyme Motif Domain 3) is a protein that has gained attention in recent years due to its potential role in various biological processes and diseases. Emerging evidence suggests that LYSMD3 may be involved in immune response regulation, apoptosis, and other cellular functions, making it a significant target for biomedical research. Its unique structure, characterized by the presence of a lysozyme-like motif, indicates potential enzymatic activity and interactions with microbial components, suggesting a role in innate immunity. Moreover, studies have indicated altered expression levels of LYSMD3 in certain cancers and inflammatory conditions, which highlights its potential as a biomarker for disease progression. The development of recombinant LYSMD3 proteins allows for in-depth studies of its functional properties, mechanisms of action, and interactions with other molecules. Such research could lead to novel therapeutic approaches that harness the biological activities of LYSMD3, paving the way for advancements in the treatment of immune-related disorders and cancers. Consequently, understanding the properties and functions of LYSMD3 through recombinant technology is crucial for unraveling its biological significance and potential applications in medicine.
