Analytical Data
-
Gene name
NUDT16
- Application
-
Alternative Names
NUDT16L1;SDOS;TIRR;Tudor-interacting repair regulator Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DE0
-
Expression Region
1-195aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAGARRLELGEALALGSGWRHACHALLYAP DPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREE LGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA KDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGL LQSGSISGLKIPAHH
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NUDT16 is a member of the Nudix hydrolase family, known for its role in nucleotide metabolism and the regulation of cellular signaling pathways. Researchers have increasingly focused on NUDT16 due to its potential implications in various biological processes, including RNA metabolism, inflammation, and the response to oxidative stress. Altered expressions of NUDT16 have been linked to multiple diseases, including cancer and neurodegenerative disorders, making it a target for therapeutic exploration. The protein is believed to hydrolyze nucleoside diphosphate derivatives, which may influence nucleotide pool homeostasis and cellular health. Current studies aim to elucidate its specific substrate preferences, mechanistic functions, and the regulation of its activity under different physiological conditions. Understanding the structure-function relationship of NUDT16 could provide insights into its role in disease mechanisms and open avenues for the development of novel therapeutic strategies. Thus, the research on NUDT16 not only enhances our understanding of fundamental cellular processes but also holds promise for advancing targeted treatments for various diseases.
