Cat: PA1000-2207

Recombinant Human NTS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NTS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NTS;Neurotensin/neuromedin N

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30990

  • Expression Region

    24-170aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMSDSEEEMKALEADFLTNMHTSKISK AHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSL EAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYIL KRQLYENKPRRPYILKRDSYYY

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NTS (Neurotensin) is a neuropeptide that plays a crucial role in various physiological processes, including the regulation of dopaminergic transmission, appetite control, and pain modulation. Research into NTS and its recombinant proteins has gained momentum due to its potential therapeutic applications in treating disorders such as schizophrenia, obesity, and pain syndromes. The ability to produce recombinant NTS proteins allows for in-depth studies of its structure-function relationships, receptor interactions, and biological effects. Furthermore, recombinant NTS can facilitate the development of novel drug delivery systems and targeted therapies. Understanding the mechanisms of action of neurotensin and its analogs enables researchers to explore NTS's role in neurological and metabolic pathways, paving the way for innovative treatments. The recombinant technology used to produce NTS enhances its availability for research and clinical applications, ultimately contributing to advancements in neuropharmacology and translational medicine. As a result, the study of NTS and its recombinant forms is vital for unlocking new therapeutic strategies and understanding complex biological systems.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US