Analytical Data
-
Gene name
apM1
- Application
-
Alternative Names
apM1；ACDC；ACRP30；APM1；Adiponectin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q60994
-
Expression Region
18-247aa
-
AA Sequence
EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
-
Molecular Weight
28.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The apM1 protein, part of the Apolipoprotein (a) family, has garnered significant attention in biochemical and biomedical research due to its crucial role in lipid metabolism and cellular interaction processes. ApM1 is primarily associated with the regulation of lipoprotein assembly and secretion, influencing various physiological functions, including cholesterol transport and cellular energy regulation. Dysregulation of apM1 has been linked to metabolic disorders, cardiovascular diseases, and other health issues, underscoring the importance of understanding its mechanisms and interactions at the molecular level. Researchers aim to investigate the structural properties, functional roles, and potential therapeutic applications of recombinant apM1 protein. By employing various biochemical techniques and expression systems, studies have focused on the purification and characterization of apM1, aiming to elucidate its functional significance in lipid homeostasis and disease pathology. The insights gained from such research not only enhance our understanding of apM1's biological importance but also pave the way for developing novel strategies to combat lipid-related diseases through targeted therapeutics and interventions.
