Cat: PA1000-2202

Recombinant Human NT5M Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NT5M

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NT5M;DNT2;5'(3')-deoxyribonucleotidase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NPB1

  • Expression Region

    32-228aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFEGGFLRKFRAR FPDQPFIALEDRRGFWVS EQYGRLRPGLSEKAISIWESKNFFFELEPL PGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGP DFL EQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQP PRRRLHSWADDWKAILDSKRPC

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NT5M, or cytosolic 5'-nucleotidase, is an enzyme implicated in nucleotide metabolism, playing a crucial role in the dephosphorylation of nucleotides, particularly in the regulation of cellular nucleotide pools. Given its significant function in purine and pyrimidine metabolism, NT5M has emerged as a focal point in various biological and clinical research areas, including cancer biology, cellular signaling, and metabolic disorders. Abnormal expression or activity of NT5M has been associated with several pathological conditions, suggesting its potential as a biomarker or therapeutic target. Recent studies have utilized recombinant NT5M proteins to investigate its enzymatic properties, substrate specificity, and role in cellular signaling pathways. Moreover, understanding the structural dynamics of NT5M through reconstitution and characterization of recombinant forms has provided insights into its regulatory mechanisms and interactions with other cellular components. Such research is pivotal for elucidating the biochemical mechanisms underlying cellular metabolism and for the development of targeted therapies in diseases where nucleotide metabolism is dysregulated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US